Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human Galectin3 (GAL3) recombinant protein |
---|---|
Uniprot ID | P17931 |
Uniprot link | http://www.uniprot.org/uniprot/P17931 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMILEHHHHHH |
Molecular weight | 27.17kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 80% |
Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Full-length |
Aliases /Synonyms | LGALS3, CBP35, GALBP, GALIG, MAC2, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, Laminin-binding protein, Lectin L-29 |
Reference | PX-P4050 |
Note | For research use only |
Galectin-3 is a member of the animal lecithin family that binds selectively to β-galactoside residues. The protein is secreted from the cell by exocytosis, which is not related to the classic secretion pathway through the endoplasmic reticulum / Golgi network. Galectin-3 is related to the inhibition of apoptosis and the development of cancer. It is usually distributed in epithelial cells of various organs, several inflammatory cells (including macrophages), dendritic cells and Kupffer cells. The expression of this lectin is regulated during inflammation, cell proliferation, cell differentiation and transactivation of viral proteins. The recombinant Galectin-3 protein was expressed in E. coli and purified by conventional chromatography techniques.
Related products
Reviews
Il n’y a pas encore d’avis.