Cart (0 Items)
Your cart is currently empty.
View ProductsHuman Leukocyte surface antigen CD47 recombinant protein
| Size | 100ug, 50ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | Human Leukocyte surface antigen CD47 recombinant protein |
|---|---|
| Uniprot ID | Q08722 |
| Uniprot link | http://www.uniprot.org/uniprot/Q08722 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGSHHHHHH |
| Molecular weight | 16.64kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | 50mM Tris-HCl pH 7.0, 150mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Partial |
| Aliases /Synonyms | CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen |
| Reference | PX-P4008 |
| Note | For research use only |
Related products
Biosimilar
Magrolimab Biosimilar – Anti-CD47 mAb – Research Grade
PX-TA1561 400€
Biosimilar
Lemzoparlimab Biosimilar – Anti-CD47 mAb – Research Grade
PX-TA1677 400€
Biosimilar
Urabrelimab Biosimilar – Anti-CD47 mAb – Research Grade
PX-TA1733 400€
Biosimilar
Ligufalimab Biosimilar – Anti-CD47 mAb – Research Grade
PX-TA1787 400€
Biosimilar
Reviews
Il n’y a pas encore d’avis.