Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Interferon-induced transmembrane protein 1(IFITM1) |
---|---|
Uniprot ID | P13164 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
Protein delivered with Tag? | C-terminal sumo tag |
Purity estimated | >90%by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1-Phe57 |
Aliases /Synonyms | Dispanin subfamily A member 2a,DSPA2a,Interferon-induced protein 17,Interferon-inducible protein 9-27,Leu-13 antigen, CD225,CD225, IFI17 |
Reference | PX-P4692 |
Note | For research use only |
Reviews
Il n’y a pas encore d’avis.