Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Interleukin-4 receptor subunit alpha(IL4R) |
---|---|
Uniprot ID | P24394 |
Uniprot link | https://www.uniprot.org/uniprot/P24394 |
Expression system | Eukaryotic expression |
Sequence | MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHGSHHHHHH |
Molecular weight | 27.3kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1-His232 |
Protein Accession | P24394 |
Spec:Entrez GeneID | 3566 |
Spec:NCBI Gene Aliases | CD124; IL4RA; IL-4RA |
Spec:SwissProtID | Q96P01 |
NCBI Reference | P24394 |
Aliases /Synonyms | IL4RA,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD_antigen: CD124 |
Reference | PX-P4860 |
Note | For research use only |
Immobilized Interleukin-4 receptor subunit alpha(IL4R) (cat. No.PX-P4860) at 0.5µg/mL (100µL/well) can bind to Dupilumab Biosimilar - Anti-IL4R, CD124 mAb (cat. No.PX-TA1308) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Reviews
Il n’y a pas encore d’avis.