Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Myeloid cell surface antigen CD33(CD33) |
---|---|
Uniprot ID | P20138 |
Uniprot link | https://www.uniprot.org/uniprot/P20138 |
Expression system | Eukaryotic expression |
Sequence | MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGSHHHHHH |
Molecular weight | 29.6kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >80% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1-His259 |
Protein Accession | P20138 |
Spec:Entrez GeneID | 945 |
Spec:NCBI Gene Aliases | p67; SIGLEC3; SIGLEC-3 |
Spec:SwissProtID | Q8TD24 |
NCBI Reference | P20138 |
Aliases /Synonyms | Sialic acid-binding Ig-like lectin 3,Siglec-3,gp67,CD_antigen: CD33,SIGLEC3 |
Reference | PX-P4861 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.