Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Receptor-interacting serine, threonine-protein kinase 4(RIPK4) |
---|---|
Uniprot ID | P57078 |
Uniprot link | https://www.uniprot.org/uniprot/P57078 |
Expression system | Prokaryotic expression |
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELI |
Molecular weight | 57.6kDa |
Protein delivered with Tag? | N-terminal GST Tag |
Purity estimated | >80% by SDS-PAGE |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Phe22-Ile286 |
Protein Accession | P57078 |
Spec:SwissProtID | Q96KH0 |
NCBI Reference | P57078 |
Aliases /Synonyms | ANKRD3, DIK,Ankyrin repeat domain-containing protein 3,PKC-delta-interacting protein kinase |
Reference | PX-P4863 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.