Cart (0 Items)
Your cart is currently empty.
View ProductsT cell receptor delta variable 1(TRDV1)
| Size | 100ug, 50ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | T cell receptor delta variable 1(TRDV1) |
|---|---|
| Uniprot ID | A0A1B0GX56 |
| Uniprot link | https://www.uniprot.org/uniprot/A0A1B0GX56 |
| Expression system | Prokaryotic expression |
| Sequence | MQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEDYKDDDDKHHHHHHHH |
| Molecular weight | 13kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Gln22-Glu115 |
| Protein Accession | A0A1B0GX56 |
| NCBI Reference | A0A1B0GX56 |
| Reference | PX-P4655 |
| Note | For research use only |
SDS-PAGE for T cell receptor delta variable 1(TRDV1)
T cell receptor delta variable 1(TRDV1), on SDS-PAGE under reducing
Related products
Tag Antibody
Reviews
Il n’y a pas encore d’avis.