Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Tumor-associated calcium signal transducer 2(TACSTD2) |
---|---|
Uniprot ID | P09758 |
Uniprot link | https://www.uniprot.org/uniprot/P09758 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
Molecular weight | 35-45kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >95% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1-Thr274 |
Protein Accession | P09758 |
Spec:Entrez GeneID | 4070 |
Spec:NCBI Gene Aliases | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 |
Spec:SwissProtID | Q15658 |
NCBI Reference | P09758 |
Aliases /Synonyms | GA733-1, M1S1, TROP2,Cell surface glycoprotein Trop-2;Membrane component chromosome 1 surface marker 1;Pancreatic carcinoma marker protein GA733-1 |
Reference | PX-P4569 |
Note | For research use only |
Immobilized Tumor-associated calcium signal transducer 2(TACSTD2) (cat. No.PX-P4569) at 0.5µg/mL (100µL/well) can bind to Sacituzumab Biosimilar - Anti-TACSTD2 mAb (cat. No.PX-TA1447) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Reviews
Il n’y a pas encore d’avis.