Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173) |
---|---|
Uniprot ID | P25445 |
Uniprot link | https://www.uniprot.org/uniprot/P25445 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF SSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG SRSN |
Molecular weight | 16.64 kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Gln26-Asn173 |
Protein Accession | P25445 |
Spec:Entrez GeneID | 355 |
Spec:NCBI Gene Aliases | APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6 |
Spec:SwissProtID | Q6SSE9 |
NCBI Reference | P25445 |
Aliases /Synonyms | APT1, FAS1, TNFRSF6,Apo-1 antigen,Apoptosis-mediating surface antigen FAS,FASLG receptor, CD95 |
Reference | PX-P4778 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.