Name: Alpha-amylase - trypsin inhibitor CM3
SKU: PX-P4286-10
Availability: InStock

Product name	Alpha-amylase - trypsin inhibitor CM3
Uniprot ID	P17314
Uniprot link	https://www.uniprot.org/uniprot/P17314
Expression system	Eukaryotic expression
Sequence	MKMIILVVSLHVLRNSAASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSKLPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVGESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWIGSHHHHHH
Molecular weight	18.74kDa
Purity estimated	>50% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Applications	ELISA,WB
Fragment Type	Ser26-IIe168
Aliases /Synonyms	Chloroform/methanol-soluble protein CM3
Reference	PX-P4286
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Alpha-amylase – trypsin inhibitor CM3”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.