Name: CD278 Recombinant Protein
SKU: PX-P4116-100
Price: 420.00 EUR
Availability: InStock

Product name	CD278 Recombinant Protein
Uniprot ID	Q9Y6W8
Uniprot link	http://www.uniprot.org/uniprot/Q9Y6W8
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Molecular weight	45kDa
Protein delivered with Tag?	C-terminal Fc Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1~ Lys140
Protein Accession	Q9Y6W8
Spec:Entrez GeneID	29851
Spec:NCBI Gene Aliases	AILIM; CD278; CVID1
Spec:SwissProtID	Q8N6W8
NCBI Reference	Q9Y6W8
Aliases /Synonyms	AILIM
Reference	PX-P4116
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “CD278 Recombinant Protein”

€420.00In stock

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1505 400€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.