CD47 Recombinant Protein (Human)

Reference: PX-P4083-100
Product nameCD47 Recombinant Protein (Human)
Uniprot IDQ08722
Uniprot linkhttp://www.uniprot.org/uniprot/Q08722
Origin speciesHomo sapiens (Human)
Expression systemEukaryotic expression
SequenceMWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDK SDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Molecular weight35kDa
Protein delivered with Tag?C-terminal His Tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH7.5
Delivery conditionDry Ice
Delivery lead time in business days3-5 days if in stock; 3-5 weeks if production needed
Storage conditionStore at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
BrandProteoGenix
Host speciesMammalian cells
ApplicationsELISA,WB
Fragment TypeMet1~Glu141
Aliases /SynonymsMER6
ReferencePX-P4083
NoteFor research use only.

Description of CD47 Recombinant Protein (Human)

General Information about CD47 Recombinant Protein

CD47 (Cluster of Differentiation 47), also known as the integrin associated protein (IAP), is a transmembrane protein which is encoded by the CD47 gene in humans. CD47 belongs to the immunoglobulin superfamily and binds to membrane integrins, as well as thrombospondin 1 (TSP-1) ligands and α signal regulatory protein (SIRPα).
CD47 is involved in a variety of cellular processes, including apoptosis, proliferation, adhesion, and migration. In addition, it plays a key role in immune and angiogenic reactions. CD47 is commonly expressed in human cells and has been shown to overexpress in many different tumor cells. It is also expressed in assorted cranial tumors.
CD47 is a membrane receptor with an extracellular N-terminal IgV domain, five transmembrane domains, and a short, C-terminal intracellular tail.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “CD47 Recombinant Protein (Human)”

Your email address will not be published. Required fields are marked *

Related products

Lemzoparlimab Biosimilar – Anti-CD47 mAb – Research Grade
Biosimilar

Lemzoparlimab Biosimilar – Anti-CD47 mAb – Research Grade

PX-TA1677 400€
Magrolimab  Biosimilar – Anti-CD47  mAb – Research Grade
Biosimilar

Magrolimab Biosimilar – Anti-CD47 mAb – Research Grade

PX-TA1561 400€
Urabrelimab Biosimilar – Anti-CD47 mAb – Research Grade
Biosimilar

Urabrelimab Biosimilar – Anti-CD47 mAb – Research Grade

PX-TA1733 400€
Ligufalimab Biosimilar – Anti-CD47 mAb – Research Grade
Biosimilar

Ligufalimab Biosimilar – Anti-CD47 mAb – Research Grade

PX-TA1787 400€
Anti ACE2 mouse monoclonal antibody
Monoclonal Antibody

Anti ACE2 mouse monoclonal antibody

PTXCOV-A564 330€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products