Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efparepoetin Biosimilar – Anti-EPO fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P01588

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Efparepoetin Biosimilar - Anti-EPO fusion protein - Research Grade

Product name PX-TA2227-50
Uniprot ID P01588
Source CAS: 2761347-19-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-EPO, Erythropoietin, Epoetin
Reference PX-TA2227-100
Note For research use only. Not suitable for human use.
Isotype Human erythropoietin fragment fused via peptide linker to a Fc fragment of Ig G2
Product name Efparepoetin Biosimilar - Anti-EPO fusion protein - Research Grade
Uniprot ID P01588
Source CAS: 2761347-19-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-EPO, Erythropoietin, Epoetin
Reference PX-TA2227-100
Note For research use only. Not suitable for human use.
Isotype Human erythropoietin fragment fused via peptide linker to a Fc fragment of Ig G2
Product name Efparepoetin Biosimilar - Anti-EPO fusion protein - Research Grade
Uniprot ID P01588
Source CAS: 2761347-19-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-EPO, Erythropoietin, Epoetin
Reference PX-TA2227-100
Note For research use only. Not suitable for human use.
Isotype Human erythropoietin fragment fused via peptide linker to a Fc fragment of Ig G2

Introduction

Efparepoetin Biosimilar, also known as Anti-EPO fusion protein, is a therapeutic protein that has been developed as a biosimilar to the erythropoietin (EPO) hormone. This biosimilar is designed to mimic the structure and function of EPO, which is a naturally occurring hormone that regulates the production of red blood cells in the body. In this article, we will discuss the structure, activity, and potential applications of Efparepoetin Biosimilar.

Structure of Efparepoetin Biosimilar

Efparepoetin Biosimilar is a fusion protein that consists of two components: the anti-EPO antibody and the EPO receptor. The anti-EPO antibody is a monoclonal antibody that specifically binds to EPO, while the EPO receptor is a protein that is responsible for the biological activity of EPO. The two components are linked together to form a single molecule, which allows for a more targeted and effective action.

The structure of Efparepoetin Biosimilar is similar to that of endogenous EPO, with a three-dimensional conformation that is essential for its biological activity. This structure is composed of two alpha helices and four beta strands, which are held together by disulfide bonds. These structural features are important for the binding and activation of the EPO receptor, which triggers the production of red blood cells.

Activity of Efparepoetin Biosimilar

The main activity of Efparepoetin Biosimilar is to stimulate the production of red blood cells, a process known as erythropoiesis. This is achieved by binding to the EPO receptor on the surface of erythropoietic cells, which are responsible for the production of red blood cells. Once bound, Efparepoetin Biosimilar activates the EPO receptor, which then initiates a signaling cascade that leads to the production and maturation of red blood cells.

In addition to its erythropoietic activity, Efparepoetin Biosimilar also has anti-inflammatory effects. This is due to the presence of the anti-EPO antibody component, which can bind to and neutralize circulating EPO. This can be beneficial in conditions where EPO levels are abnormally high, such as in chronic kidney disease, where EPO is overproduced and contributes to inflammation.

Therapeutic Applications of Efparepoetin Biosimilar

Efparepoetin Biosimilar has several potential therapeutic applications, with the most common being the treatment of anemia. Anemia is a condition characterized by a decrease in the number of red blood cells, which can lead to fatigue, weakness, and other symptoms. Efparepoetin Biosimilar can be used to treat anemia in patients with chronic kidney disease, cancer, and other conditions that result in reduced EPO production.

Another potential application of Efparepoetin Biosimilar is in the treatment of inflammatory disorders. By neutralizing circulating EPO, this biosimilar can help reduce inflammation and improve symptoms in conditions such as rheumatoid arthritis and psoriasis.

Furthermore, Efparepoetin Biosimilar can also be used as a research tool for studying the role of EPO in various diseases and for developing new treatments. Its unique structure and activity make it a valuable tool for investigating the biological effects of EPO and its potential therapeutic applications.

Conclusion

In conclusion, Efparepoetin Biosimilar is a promising therapeutic protein that has been developed as a biosimilar to EPO. Its unique structure, activity, and potential applications make it a valuable addition to the field of therapeutic proteins. With further research and development, Efparepoetin Biosimilar has the potential to improve the treatment of anemia, inflammatory disorders, and other conditions that involve EPO.

SDS-PAGE for Efparepoetin Alfa Biosimilar - Research Grade

SDS-PAGE for Efparepoetin Alfa Biosimilar - Research Grade

Efparepoetin Alfa Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Efparepoetin Biosimilar – Anti-EPO fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products