Cart (0 Items)
Your cart is currently empty.
View ProductsG1-S specific cyclin-D1(CCND1)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | G1-S specific cyclin-D1(CCND1) |
|---|---|
| Uniprot ID | P24385 |
| Uniprot link | https://www.uniprot.org/uniprot/P24385 |
| Expression system | Prokaryotic expression |
| Sequence | LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR |
| Molecular weight | 20.69 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Leu65-Arg245 |
| Protein Accession | P24385 |
| Spec:Entrez GeneID | 595 |
| Spec:NCBI Gene Aliases | BCL1; PRAD1; U21B31; D11S287E |
| Spec:SwissProtID | Q6LEF0 |
| NCBI Reference | P24385 |
| Aliases /Synonyms | B-cell lymphoma 1 protein,BCL-1,BCL-1 oncogene,PRAD1 oncogene,BCL1, PRAD1 |
| Reference | PX-P4712 |
| Note | For research use only |
Related products
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.