Name: Glucagon-like peptide 1 receptor(GLP1R) protein
SKU: PX-P4732-10
Availability: InStock

Product name	Glucagon-like peptide 1 receptor(GLP1R) protein
Uniprot ID	P43220
Uniprot link	https://www.uniprot.org/uniprot/P43220
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight	14.31 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>95%by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Arg24-Tyr145
Protein Accession	P43220
Spec:Entrez GeneID	2740
Spec:NCBI Gene Aliases	GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID	Q2M229
NCBI Reference	P43220
Aliases /Synonyms	GLP-1 receptor，GLP-1-R，GLP-1R
Reference	PX-P4732
Note	For research use only

No Products found