Name: Glutamate racemase(murI)
SKU: PX-P4527-10
Availability: InStock

Product name	Glutamate racemase(murI)
Uniprot ID	B5QXR2
Uniprot link	http://www.uniprot.org/uniprot/B5QXR2
Expression system	Prokaryotic expression
Sequence	MGKYLLPTAAAGLLLLAAQPAMAMATKLQDENTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRRLLPDLHYIYAFDNVA FPYGEKSETFIVERVVEIVTAVQQRYPLSLAVIACNTASTVSLPALREKFAFPVVGVVPAIKPAARLTANGVVGLLATRA TVKRPYTHELIARFANECQIAMLGSAELVELAEAKLHGDSVSLEELRRILRPWLRMPEPPDTVVLGCTHFPLLRDELLQV LPEGTRLVDSGAAIARRTAWLLEHEAPDAKSTDANIAYCMAMTPGAEQLLPVLQRYGFETLEKLPVGSHHHHHH
Molecular weight	34.22kDa
Purity estimated	90% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	full length
Reference	PX-P4527
Note	For research use only

Description of Glutamate racemase(murI)

General Information about Glutamate racemase (murI)

Provides the (R)-glutamate required for cell wall biosynthesis.

Reviews

There are no reviews yet.

Be the first to review “Glutamate racemase(murI)”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.