Name: Growth/differentiation factor 11(GDF11)
SKU: PX-P4823-10
Availability: InStock

Product name	Growth/differentiation factor 11(GDF11)
Uniprot ID	O95390
Uniprot link	https://www.uniprot.org/uniprot/O95390
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAG PCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Molecular weight	13.7kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>70% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Asn299-Ser407
Protein Accession	O95390
Spec:Entrez GeneID	10220
Spec:NCBI Gene Aliases	VHO; BMP11; BMP-11
NCBI Reference	O95390
Aliases /Synonyms	Bone morphogenetic protein 11,Bone morphogenetic protein 11,BMP-11,BMP11
Reference	PX-P4823
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Growth/differentiation factor 11(GDF11)”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.