Name: Human CD123 Recombinant Protein
SKU: PX-P2057-10
Availability: InStock

Product name	Human CD123 Recombinant Protein
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MKLHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAENLYFQGTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPW
Molecular weight	23.70 kDa
Protein delivered with Tag?	Yes
Buffer	50mM Tris, NaCl 150mM , DTT 1mM pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Unknown
Protein Accession	XP_005274489
NCBI Reference	XP_005274489
Aliases /Synonyms	CD123
Reference	PX-P2057
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human CD123 Recombinant Protein”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1093 400€

View product

Biosimilar

PX-TA1456 400€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.