Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human CD80, B7-1 recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human CD80, B7-1 recombinant protein |
|---|---|
| Uniprot ID | P33681 |
| Uniprot link | http://www.uniprot.org/uniprot/P33681 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSHHHHHH |
| Molecular weight | 28.52kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD80, CD28LG, CD28LG1, BB1, B7-1 Antigen, T-lymphocyte activation antigen CD80, CTLA-4 counter-receptor B7.1 |
| Reference | PX-P4040 |
| Note | For research use only |
Description of Human CD80, B7-1 recombinant protein
General Information about Human CD80/B7-1 recombinant protein
Cluster of Differentiation 80 (CD80/B7-1), recombinant human protein is supplied as a lyophilized powder. It is suitable for analysis of protein structure, investigation of protein-protein interactions, and specific biological research applications. It can also be used as an immunogen or protein standard.
Related products
Biosimilar
Galiximab Biosimilar – Anti-CD80 mAb – Research Grade
PX-TA1843 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.