Name: Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
SKU: PX-P3003-10
Availability: InStock

Product name	Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
Uniprot ID	P0DJI8
Uniprot link	http://www.uniprot.org/uniprot/P0DJI8
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Molecular weight	13.2 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	Tris-HC 50mMl, NaCl 150mM, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Spec:NCBI Gene Aliases	SAA1
NCBI Reference	P0DJI8
Aliases /Synonyms	Serum amyloid A-1 protein, SAA, Amyloid fibril protein AA
Reference	PX-P3003
Note	For research use only

No Products found