Name: Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein
SKU: PX-P3015-10
Availability: InStock

Product name	Human Tryptase alpha, beta-1(TPSAB1) Recombinant Protein
Uniprot ID	Q15661
Uniprot link	http://www.uniprot.org/uniprot/Q15661
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPGSHHHHHH
Molecular weight	31.23 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	NaCl 150mM, Tris-HCl 50 mM, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Full-length
NCBI Reference	Q15661
Aliases /Synonyms	TPSAB1, Tryptase Alpha/Beta 1, Tryptase Alpha II, Tryptase Beta I, Tryptase-I, Tryptase-II, Tryptase-III,Tryptase, TPS
Reference	PX-P3015
Note	For research use only

No Products found