Name: Immunoglobulin G-binding protein G(spg)
SKU: PX-P4551-10
Availability: InStock

Product name	Immunoglobulin G-binding protein G(spg)
Uniprot ID	P19909
Uniprot link	http://www.uniprot.org/uniprot/P19909
Expression system	Prokaryotic expression
Sequence	KGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Molecular weight	20.96KDa（25-35kDa)
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Lys314~Glu497
Aliases /Synonyms	IgG-binding protein G
Reference	PX-P4551
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Immunoglobulin G-binding protein G(spg)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PX-TA1100 400€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.