Name: Immunoglobulin G-binding protein G(spg) His Tag
SKU: PX-P4645-10
Availability: InStock

Product name	Immunoglobulin G-binding protein G(spg) His Tag
Uniprot ID	P19909
Uniprot link	https://www.uniprot.org/uniprot/P19909
Origin species	Streptococcus sp. group G
Expression system	Prokaryotic expression
Sequence	MGKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEHHHHHH
Molecular weight	21.24kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Lys314-Glu497
Protein Accession	P19909
NCBI Reference	P19909
Aliases /Synonyms	IgG-binding protein G
Reference	PX-P4645
Note	For research use only

No Products found