Name: Interferon alpha
SKU: PX-P4357-10
Availability: InStock

Product name	Interferon alpha
Uniprot ID	A0PA06
Uniprot link	https://www.uniprot.org/uniprot/A0PA06
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGENLYFQGCDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE
Molecular weight	20.85KDa
Purity estimated	90%
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Cys24-Glu186
Aliases /Synonyms	Interferon alpha
Reference	PX-P4357
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Interferon alpha”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.