Cart (0 Items)
Your cart is currently empty.
View ProductsInterleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328) |
|---|---|
| Uniprot ID | P29459&P29460 |
| Uniprot link | https://www.uniprot.org/uniprot/P29459 & https://www.uniprot.org/uniprot/P29460 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Molecular weight | 40kDa & 43kDa |
| Protein delivered with Tag? | C-terminal Strep tag & C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Il12A(Met1-Ser219) & Il12B( Met1-Ser328) |
| Protein Accession | P29459&P29460 |
| Spec:Entrez GeneID | 3592 & 3593 |
| Spec:NCBI Gene Aliases | P35; CLMF; NFSK; NKSF1; IL-12A; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B |
| Spec:SwissProtID | Q96QZ1 |
| NCBI Reference | P29459&P29460 |
| Aliases /Synonyms | IL12AB |
| Reference | PX-P4576 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.