Name: Interleukin-31 receptor subunit alpha(IL31RA)
SKU: PX-P4802-10
Availability: InStock

Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Signal Transduction Neuroscience Immunology

Product name	Interleukin-31 receptor subunit alpha(IL31RA)
Uniprot ID	Q8NI17
Uniprot link	https://www.uniprot.org/uniprot/Q8NI17
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIAL RCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPE SNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKW QSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAK EGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTS YIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPA ESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTD
Molecular weight	55.75 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Val130-Asp622
Protein Accession	Q8NI17
Spec:Entrez GeneID	133396
Spec:NCBI Gene Aliases	CRL; GPL; CRL3; GLMR; GLM-R; PLCA2; hGLM-R; IL-31RA; PRO21384; zcytoR17
Spec:SwissProtID	Q8WYJ0
NCBI Reference	Q8NI17
Aliases /Synonyms	IL-31 receptor subunit alpha，IL-31R subunit alpha，IL-31R-alpha，IL-31RA，Cytokine receptor-like 3，GLM-R，hGLM-R，Gp130-like monocyte receptor，Gp130-like receptor，ZcytoR17，CRL3, GPL
Reference	PX-P4802
Note	For research use only