Name: Lipolysis-stimulated lipoprotein receptor(LSR)
SKU: PX-P4845-10
Availability: InStock

Product name	Lipolysis-stimulated lipoprotein receptor(LSR)
Uniprot ID	Q86X29
Uniprot link	https://www.uniprot.org/uniprot/Q86X29
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDD LTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
Molecular weight	13.5kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met431-Ser540
Protein Accession	Q86X29
Spec:Entrez GeneID	51599
Spec:NCBI Gene Aliases	ILDR3; LISCH7
Spec:SwissProtID	Q6ZT80
NCBI Reference	Q86X29
Aliases /Synonyms	LISCH
Reference	PX-P4845
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Lipolysis-stimulated lipoprotein receptor(LSR)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.