Name: Lipolysis-stimulated lipoprotein receptor(LSR)
SKU: PX-P4845-10
Availability: InStock

Product name	Lipolysis-stimulated lipoprotein receptor(LSR)
Uniprot ID	Q86X29
Uniprot link	https://www.uniprot.org/uniprot/Q86X29
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDD LTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
Molecular weight	13.5kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met431-Ser540
Protein Accession	Q86X29
Spec:Entrez GeneID	51599
Spec:NCBI Gene Aliases	ILDR3; LISCH7
Spec:SwissProtID	Q6ZT80
NCBI Reference	Q86X29
Aliases /Synonyms	LISCH
Reference	PX-P4845
Note	For research use only

No Products found