Name: Mite allergen Blo t 5(BLOT5)
SKU: PX-P4389-10
Availability: InStock

Product name	Mite allergen Blo t 5(BLOT5)
Uniprot ID	O96870
Uniprot link	https://www.uniprot.org/uniprot/O96870
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Molecular weight	16.22KDa
Purity estimated	90% by SDS-PAGE
Buffer	50 mM Tris-HCl pH 8.0, 150 mMNaCl
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Gln18-Gln134
Aliases /Synonyms	BLOT5/Mite allergen Blo t
Reference	PX-P4389
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mite allergen Blo t 5(BLOT5)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.