Name: Mucin-1(Ser24-Pro146)
SKU: PX-P4730-10
Availability: InStock

Product name	Mucin-1(Ser24-Pro146)
Uniprot ID	P15941
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGSSHHHHHHSSGLVPRGSHMSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRP
Molecular weight	14.25 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Ser24-Pro146
Aliases /Synonyms	MUC-1,Breast carcinoma-associated antigen DF3,Cancer antigen 15-3,CA 15-3,Carcinoma-associated mucin,Episialin,H23AG,Krebs von den Lungen-6,KL-6 ,PEMT,Peanut-reactive urinary mucin,PUM,Polymorphic epithelial mucin,PEM,Tumor-associated epithelial membrane antigen,EMA,Tumor-associated mucin ,CD_antigen: CD227
Reference	PX-P4730
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mucin-1(Ser24-Pro146)”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product