Name: Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)
SKU: PX-P4850-10
Availability: InStock

Product name	Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)
Uniprot ID	P27986
Uniprot link	https://www.uniprot.org/uniprot/P27986
Expression system	Prokaryotic expression
Sequence	MWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVLEHHHHHH
Molecular weight	11.8kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>80% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Trp624-Val718
Protein Accession	P27986
Spec:Entrez GeneID	5295
Spec:NCBI Gene Aliases	p85; AGM7; GRB1; IMD36; p85-ALPHA
Spec:SwissProtID	Q15747
NCBI Reference	P27986
Aliases /Synonyms	PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha,GRB1
Reference	PX-P4850
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product