Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP6V1E1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P36543
Molecular weight:
28.31 kDa

Original price was: €258.00.Current price is: €230.00.

50ug 11% OFF + 230 loyalty points
Met1–Asp226
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP6V1E1 Protein, N-His

Product name ARO-P11632-100
Uniprot ID P36543
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Molecular weight 28.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp226
Aliases /Synonyms ATP6E, ATP6E2, ATP6V1E1, V-ATPase 31 kDa subunit, V-ATPase subunit E 1, p31, V-type proton ATPase subunit E 1, Vacuolar proton pump subunit E 1
Reference ARO-P11632
Note For research use only.
Molecular Constructor
Met1–Asp226
Product name ARO-P11632-1MG
Uniprot ID P36543
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Molecular weight 28.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp226
Aliases /Synonyms ATP6E, ATP6E2, ATP6V1E1, V-ATPase 31 kDa subunit, V-ATPase subunit E 1, p31, V-type proton ATPase subunit E 1, Vacuolar proton pump subunit E 1
Reference ARO-P11632
Note For research use only.
Molecular Constructor
Met1–Asp226
Product name ARO-P11632-50
Uniprot ID P36543
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Molecular weight 28.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp226
Aliases /Synonyms ATP6E, ATP6E2, ATP6V1E1, V-ATPase 31 kDa subunit, V-ATPase subunit E 1, p31, V-type proton ATPase subunit E 1, Vacuolar proton pump subunit E 1
Reference ARO-P11632
Note For research use only.
Molecular Constructor
Met1–Asp226

Introduction

The Recombinant Human ATP6V1E1 Protein is a highly purified, recombinant form of the ATP6V1E1 protein, which is a subunit of the vacuolar ATPase (V-ATPase) complex. This protein plays a crucial role in the acidification of intracellular compartments and is essential for various cellular processes. In this article, we will discuss the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human ATP6V1E1 Protein

The Recombinant Human ATP6V1E1 Protein is a 35 kDa protein consisting of 314 amino acids. It shares 97% sequence identity with the native human ATP6V1E1 protein. The recombinant protein is produced in a mammalian expression system, ensuring proper folding and post-translational modifications, making it functionally equivalent to the native protein.

The ATP6V1E1 protein is a subunit of the V-ATPase complex, which is composed of multiple subunits and is found in the membranes of various organelles, including the endosomes, lysosomes, and Golgi apparatus. The V-ATPase complex is responsible for maintaining the acidic pH in these compartments, which is essential for various cellular processes, such as protein degradation, receptor-mediated endocytosis, and membrane trafficking.

Activity of Recombinant Human ATP6V1E1 Protein

The Recombinant Human ATP6V1E1 Protein is a key component of the V-ATPase complex, and its activity is crucial for maintaining the acidic pH in intracellular compartments. This is achieved by the hydrolysis of ATP, which provides the energy for the V-ATPase complex to pump protons from the cytoplasm into the lumen of these compartments. The resulting low pH is necessary for the proper functioning of various enzymes and transporters, as well as for the activation of certain proteins.

In addition to its role in acidification, the ATP6V1E1 protein has also been shown to be involved in other cellular processes, such as autophagy, cell migration, and cell proliferation. It has been reported that mutations in the ATP6V1E1 gene can lead to lysosomal storage disorders, highlighting the importance of this protein in maintaining cellular homeostasis.

Applications of Recombinant Human ATP6V1E1 Protein

The Recombinant Human ATP6V1E1 Protein has various applications in both research and therapeutic settings. Its ability to maintain the acidic pH in intracellular compartments makes it a valuable tool for studying the function of these compartments in different cellular processes. It can also be used to investigate the role of the V-ATPase complex in diseases associated with lysosomal dysfunction, such as lysosomal storage disorders and cancer.

In therapeutic applications, the Recombinant Human ATP6V1E1 Protein can be used as an antigen for the production of specific antibodies. These antibodies can be used for diagnostic purposes, such as in immunohistochemistry and Western blotting, or for therapeutic purposes, such as targeted drug delivery. Additionally, the ATP6V1E1 protein has been identified as a potential target for the development of new drugs to treat lysosomal storage disorders and cancer.

Conclusion

The Recombinant Human ATP6V1E1 Protein is a highly purified, recombinant form of the ATP6V1E1 protein, which plays a crucial role in the acidification of intracellular compartments. Its structure, activity, and applications make it a valuable tool for studying various cellular processes and a potential target for therapeutic interventions. Further research on this protein will undoubtedly provide valuable insights into its role in maintaining cellular homeostasis and its potential as a therapeutic target.

Recombinant Human ATP6V1E1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ATP6V1E1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products