Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CISD1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZ45
Molecular weight:
22.89 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Ala16–Thr108
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CISD1 Protein, N-His-SUMO

Product name ARO-P11185-100
Uniprot ID Q9NZ45
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala16-Thr108
Aliases /Synonyms CISD1, CDGSH iron-sulfur domain-containing protein 1, MitoNEET, C10orf70, ZCD1
Reference ARO-P11185
Note For research use only.
Molecular Constructor
Ala16–Thr108
Product name ARO-P11185-1MG
Uniprot ID Q9NZ45
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala16-Thr108
Aliases /Synonyms CISD1, CDGSH iron-sulfur domain-containing protein 1, MitoNEET, C10orf70, ZCD1
Reference ARO-P11185
Note For research use only.
Molecular Constructor
Ala16–Thr108
Product name ARO-P11185-50
Uniprot ID Q9NZ45
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala16-Thr108
Aliases /Synonyms CISD1, CDGSH iron-sulfur domain-containing protein 1, MitoNEET, C10orf70, ZCD1
Reference ARO-P11185
Note For research use only.
Molecular Constructor
Ala16–Thr108

Title: Introduction to Recombinant Human CISD1 Protein

Recombinant Human CISD1 Protein, also known as CDGSH iron sulfur domain-containing protein 1, is a highly conserved protein that plays a crucial role in maintaining cellular homeostasis. This protein is encoded by the CISD1 gene and is found in the mitochondria of eukaryotic cells. In recent years, recombinant human CISD1 protein has gained significant attention due to its potential therapeutic applications in various diseases. In this article, we will provide a comprehensive overview of the structure, activity, and applications of recombinant human CISD1 protein.

Title: Structure of Recombinant Human CISD1 Protein

The recombinant human CISD1 protein is a small, 14 kDa protein that contains a conserved CDGSH iron-sulfur domain at its N-terminus. This domain is essential for the protein’s function, as it binds to iron-sulfur clusters and facilitates their transfer to other proteins. The C-terminus of the protein contains a transmembrane domain, which anchors the protein to the inner mitochondrial membrane. This unique structure allows the protein to interact with other mitochondrial proteins and play a vital role in maintaining mitochondrial function.

Title: Activity of Recombinant Human CISD1 Protein

The primary function of recombinant human CISD1 protein is to regulate iron-sulfur cluster biogenesis and transfer in the mitochondria. Iron-sulfur clusters are essential for various cellular processes, including respiration, DNA repair, and metabolism. CISD1 protein interacts with other proteins, such as frataxin and ISCU, to facilitate the formation and transfer of iron-sulfur clusters. This activity is crucial for maintaining the proper functioning of mitochondria and preventing oxidative stress.

Moreover, recombinant human CISD1 protein has been shown to play a role in regulating apoptosis, or programmed cell death. Studies have demonstrated that overexpression of CISD1 protein can protect cells from apoptosis induced by oxidative stress, while its depletion can enhance apoptosis. This suggests that recombinant human CISD1 protein may have therapeutic potential in diseases characterized by excessive cell death, such as neurodegenerative disorders.

Title: Applications of Recombinant Human CISD1 Protein

The unique structure and activity of recombinant human CISD1 protein make it a promising candidate for various therapeutic applications. One potential application is in the treatment of neurodegenerative disorders, such as Parkinson’s and Alzheimer’s disease. These diseases are characterized by mitochondrial dysfunction and oxidative stress, which can be mitigated by the activity of CISD1 protein. Studies have shown that overexpression of CISD1 protein can protect neurons from oxidative stress and improve mitochondrial function, making it a potential therapeutic target for these diseases.

Another potential application of recombinant human CISD1 protein is in cancer treatment. CISD1 protein has been found to be downregulated in various types of cancer, and its overexpression has been shown to inhibit tumor growth and promote cell death. This suggests that recombinant human CISD1 protein may have anti-cancer properties and could be used as a targeted therapy for certain types of cancer.

In addition to its therapeutic applications, recombinant human CISD1 protein also has diagnostic potential. CISD1 protein has been identified as a potential biomarker for various diseases, including cardiovascular diseases and diabetes. Its levels have been found to be altered in patients with these conditions, making it a potential diagnostic marker for early detection and monitoring of disease progression.

Title: Conclusion

In summary, recombinant human CISD1 protein is a small but crucial protein that plays a vital role in maintaining cellular homeostasis. Its unique structure and activity make it a promising candidate for various therapeutic and diagnostic applications. Further research and development of recombinant human CISD1 protein could lead to the development of new treatments for diseases such as neurodegenerative disorders and cancer, ultimately improving the quality of life for patients.

Recombinant Human CISD1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CISD1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products