Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGF16 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43320
Molecular weight:
32.52 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Asn35–Arg207
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGF16 Protein, N-His-SUMO

Product name ARO-P11539-100
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 32.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11539
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P11539-1MG
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 32.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11539
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P11539-50
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 32.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11539
Note For research use only.
Molecular Constructor
Asn35–Arg207

Introduction

Recombinant Human FGF16 Protein, also known as Fibroblast Growth Factor 16, is a member of the FGF family of proteins that play crucial roles in cell proliferation, differentiation, and survival. FGF16 is a 23 kDa protein that is encoded by the FGF16 gene located on chromosome 3 in humans. It is produced through recombinant DNA technology and has a wide range of applications in research and medicine.

Structure of Recombinant Human FGF16 Protein

The primary structure of Recombinant Human FGF16 Protein consists of 207 amino acids with a predicted molecular weight of 23 kDa. It contains a signal peptide, a heparin-binding domain, and a receptor-binding domain. The crystal structure of FGF16 has been determined, revealing a β-trefoil fold with three anti-parallel β-sheets and a central α-helix. This structure is similar to other members of the FGF family, such as FGF1 and FGF2.

Activity of Recombinant Human FGF16 Protein

Recombinant Human FGF16 Protein is a potent mitogen that binds to and activates the FGF receptor (FGFR) family. It has a high affinity for FGFR1c, FGFR2c, and FGFR3c isoforms, and a lower affinity for FGFR4. Upon binding to its receptor, FGF16 triggers a cascade of signaling events, including the activation of the MAPK and PI3K pathways, leading to cell proliferation, survival, and differentiation.

In addition to its mitogenic activity, FGF16 has been shown to have neurotrophic effects, promoting the survival and differentiation of neurons. It also plays a role in angiogenesis, the formation of new blood vessels, by stimulating the proliferation and migration of endothelial cells.

Applications of Recombinant Human FGF16 Protein

Recombinant Human FGF16 Protein has a wide range of applications in research and medicine. In research, it is commonly used as a growth factor to stimulate cell proliferation and differentiation in cell culture experiments. It is also used to study the role of FGF16 in various biological processes, such as angiogenesis and neurodevelopment.

In medicine, FGF16 has potential therapeutic applications in the treatment of various diseases. Its mitogenic and neurotrophic properties make it a promising candidate for tissue repair and regeneration. It has also been studied for its potential role in treating neurological disorders, such as Parkinson’s disease and Alzheimer’s disease.

Furthermore, FGF16 has been shown to have anti-inflammatory effects, making it a potential therapeutic target for inflammatory diseases, such as arthritis and inflammatory bowel disease. It has also been studied for its potential in promoting wound healing and tissue repair in diabetic patients.

Conclusion

In summary, Recombinant Human FGF16 Protein is a 23 kDa protein that plays important roles in cell proliferation, differentiation, and survival. Its structure consists of a β-trefoil fold with three anti-parallel β-sheets and a central α-helix. FGF16 binds to and activates FGFRs, triggering a cascade of signaling events that promote cell growth and survival. It has a wide range of applications in research and medicine, including tissue regeneration and treatment of various diseases. Further studies on the properties and functions of FGF16 may lead to its potential use in clinical settings for the treatment of various diseases.

Recombinant Human FGF16 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human FGF16 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products