Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GMFB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P60983
Molecular weight:
18.88 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Met1–His142
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GMFB Protein, N-His

Product name ARO-P11217-100
Uniprot ID P60983
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Molecular weight 18.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His142
Aliases /Synonyms Glia maturation factor beta, GMFB, GMF-beta
Reference ARO-P11217
Note For research use only.
Molecular Constructor
Met1–His142
Product name ARO-P11217-1MG
Uniprot ID P60983
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Molecular weight 18.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His142
Aliases /Synonyms Glia maturation factor beta, GMFB, GMF-beta
Reference ARO-P11217
Note For research use only.
Molecular Constructor
Met1–His142
Product name ARO-P11217-50
Uniprot ID P60983
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Molecular weight 18.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His142
Aliases /Synonyms Glia maturation factor beta, GMFB, GMF-beta
Reference ARO-P11217
Note For research use only.
Molecular Constructor
Met1–His142

Introduction to Recombinant Human GMFB Protein

Recombinant Human GMFB Protein, also known as Glia Maturation Factor Beta, is a protein that plays an important role in regulating the immune response and promoting cell growth and survival. This protein is produced through recombinant DNA technology, making it a valuable tool in various scientific and medical applications.

Structure of Recombinant Human GMFB Protein

Recombinant Human GMFB Protein is a small protein consisting of 141 amino acids. It has a molecular weight of approximately 16 kDa and is composed of a single polypeptide chain. The protein contains a highly conserved cysteine-rich domain, which is responsible for its biological activity. This domain is essential for the protein’s interaction with other molecules and its role in cellular signaling.

Activity of Recombinant Human GMFB Protein

The main activity of Recombinant Human GMFB Protein is its ability to modulate the immune response. It has been shown to enhance the production of cytokines, such as interleukin-6 and tumor necrosis factor-alpha, which are important mediators of the immune response. This activity is crucial for the effective functioning of the immune system, as it helps to regulate the balance between pro-inflammatory and anti-inflammatory responses.

In addition to its role in the immune system, Recombinant Human GMFB Protein also plays a role in promoting cell growth and survival. It has been shown to stimulate the proliferation and differentiation of various cell types, including neurons, glial cells, and immune cells. This activity is important for tissue repair and regeneration, making Recombinant Human GMFB Protein a potentially valuable therapeutic agent.

Application of Recombinant Human GMFB Protein

Recombinant Human GMFB Protein has a wide range of applications in both scientific research and medical treatments. Due to its ability to modulate the immune response, it is commonly used in studies related to immunology and inflammation. It has also been used in the development of vaccines and immunotherapies for various diseases.

In the field of neurobiology, Recombinant Human GMFB Protein has been shown to promote the growth and survival of neurons, making it a potential treatment for neurodegenerative diseases such as Alzheimer’s and Parkinson’s. It has also been studied for its potential role in promoting nerve regeneration after injury.

In the medical field, Recombinant Human GMFB Protein has been investigated as a potential treatment for autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. Its ability to regulate the immune response makes it a promising candidate for these conditions, which are characterized by an overactive immune system.

Furthermore, Recombinant Human GMFB Protein has been studied for its potential role in cancer treatment. It has been shown to inhibit the growth and survival of certain cancer cells, making it a potential therapeutic agent for various types of cancer.

Conclusion

In summary, Recombinant Human GMFB Protein is a small but powerful protein with a wide range of biological activities. Its ability to modulate the immune response and promote cell growth and survival makes it a valuable tool in scientific research and a potential therapeutic agent for various diseases. With ongoing studies and advancements in technology, the potential applications of this protein are constantly expanding, making it an exciting area of research in the field of biotechnology.

Recombinant Human GMFB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GMFB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products