Name: Recombinant Human Insulin-like growth factor-binding protein 1 (IGFBP1)
SKU: PX-P4057-10
Availability: InStock

Product name	Recombinant Human Insulin-like Growth Factor proteins-binding protein 1 (IGFBP1)
Uniprot ID	P08833
Uniprot link	http://www.uniprot.org/uniprot/P08833
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQNGSHHHHHH
Molecular weight	28.82kDa
Protein delivered with Tag?	Yes
Purity estimated	60%-70%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Full-length
Aliases /Synonyms	IGFBP1, IBP1, AFBP, IGF-BP25, PP12, Placental Protein 12, Amniotic Fluid Binding Protein, Alpha-Pregnancy-Associated Endometrial Globulin, Growth Hormone Independent-Binding Protein
Reference	PX-P4057
Note	For research use only

No Products found