Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KHDRBS1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q07666
Molecular weight:
21.26 kDa

Original price was: €297.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Lys111–Gly276
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KHDRBS1 Protein, N-His

Product name ARO-P11642-100
Uniprot ID Q07666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNG
Molecular weight 21.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys111-Gly276
Aliases /Synonyms p21 Ras GTPase-activating protein-associated p62, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, SAM68, p68, Sam68, KHDRBS1, Src-associated in mitosis 68 kDa protein
Reference ARO-P11642
Note For research use only.
Molecular Constructor
Lys111–Gly276
Product name ARO-P11642-1MG
Uniprot ID Q07666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNG
Molecular weight 21.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys111-Gly276
Aliases /Synonyms p21 Ras GTPase-activating protein-associated p62, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, SAM68, p68, Sam68, KHDRBS1, Src-associated in mitosis 68 kDa protein
Reference ARO-P11642
Note For research use only.
Molecular Constructor
Lys111–Gly276
Product name ARO-P11642-50
Uniprot ID Q07666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNG
Molecular weight 21.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys111-Gly276
Aliases /Synonyms p21 Ras GTPase-activating protein-associated p62, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, SAM68, p68, Sam68, KHDRBS1, Src-associated in mitosis 68 kDa protein
Reference ARO-P11642
Note For research use only.
Molecular Constructor
Lys111–Gly276

Introduction

Recombinant Human KHDRBS1 Protein, also known as KH domain-containing, RNA-binding, signal transduction-associated protein 1, is a highly conserved protein found in all eukaryotic organisms. It plays a crucial role in regulating various cellular processes, including RNA metabolism, signal transduction, and cell differentiation. In this article, we will explore the structure, activity, and applications of this important protein.

Structure of Recombinant Human KHDRBS1 Protein

The KHDRBS1 gene is located on chromosome 1 in humans and consists of 10 exons. The protein is composed of 437 amino acids and has a molecular weight of approximately 50 kDa. It contains three KH domains, which are RNA-binding domains that are involved in the recognition and binding of specific RNA sequences. These domains are essential for the proper functioning of KHDRBS1 in RNA metabolism and signal transduction.

In addition to the KH domains, Recombinant Human KHDRBS1 Protein also contains a proline-rich region and a tyrosine-rich region. These regions are important for protein-protein interactions and play a role in the regulation of KHDRBS1 activity.

Activity of Recombinant Human KHDRBS1 Protein

The main function of KHDRBS1 is to regulate RNA metabolism by binding to specific RNA sequences and influencing their processing, transport, and translation. It has been found to interact with various RNA-binding proteins, including splicing factors, poly(A)-binding protein, and mRNA decay factors, to modulate RNA splicing and stability.

In addition to its role in RNA metabolism, KHDRBS1 is also involved in signal transduction pathways. It has been shown to interact with various signaling molecules, such as protein kinases and phosphatases, and regulate their activity. This suggests that KHDRBS1 may play a role in cell signaling and cell differentiation processes.

Applications of Recombinant Human KHDRBS1 Protein

The recombinant form of KHDRBS1 protein has been widely used in various research studies to investigate its structure, function, and potential therapeutic applications. Some of the applications of this protein include:

1. Studying RNA metabolism

Recombinant Human KHDRBS1 Protein has been used in in vitro and in vivo studies to understand its role in RNA metabolism. By manipulating the expression or activity of KHDRBS1, researchers can study the effects on RNA processing, transport, and translation, providing insights into the mechanisms of RNA regulation in cells.

2. Investigating signal transduction pathways

As KHDRBS1 is involved in signal transduction pathways, recombinant protein has been used to study its interactions with various signaling molecules and its role in regulating their activity. This has helped to elucidate the role of KHDRBS1 in cell signaling and its potential implications in diseases such as cancer.

3. Drug development

Due to its involvement in various cellular processes, KHDRBS1 has been identified as a potential target for drug development. Recombinant Human KHDRBS1 Protein has been used in high-throughput screening assays to identify small molecules that can modulate its activity. These molecules can then be further developed into potential therapeutics for diseases associated with KHDRBS1 dysregulation.

4. Diagnostic tool

KHDRBS1 has been found to be overexpressed in certain types of cancers, making it a potential diagnostic marker. Recombinant Human KHDRBS1 Protein has been used in immunoassays to detect the presence of KHDRBS1 in patient samples, providing a potential tool for cancer diagnosis and prognosis.

5. Vaccine development

Recombinant Human KHDRBS1 Protein has been used as an antigen in vaccine development.

Recombinant Human KHDRBS1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KHDRBS1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products