Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RIOK3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O14730
Molecular weight:
33.69 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Ser247–Glu519
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RIOK3 Protein, N-His

Product name ARO-P11623-100
Uniprot ID O14730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Molecular weight 33.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Glu519
Aliases /Synonyms Serine/threonine-protein kinase RIO3, SUDD, sudD homolog, RIO kinase 3, RIOK3
Reference ARO-P11623
Note For research use only.
Molecular Constructor
Ser247–Glu519
Product name ARO-P11623-1MG
Uniprot ID O14730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Molecular weight 33.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Glu519
Aliases /Synonyms Serine/threonine-protein kinase RIO3, SUDD, sudD homolog, RIO kinase 3, RIOK3
Reference ARO-P11623
Note For research use only.
Molecular Constructor
Ser247–Glu519
Product name ARO-P11623-50
Uniprot ID O14730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFKNRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Molecular weight 33.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Glu519
Aliases /Synonyms Serine/threonine-protein kinase RIO3, SUDD, sudD homolog, RIO kinase 3, RIOK3
Reference ARO-P11623
Note For research use only.
Molecular Constructor
Ser247–Glu519

The Structure of Recombinant Human RIOK3 Protein

Recombinant Human RIOK3 Protein is a highly conserved protein that belongs to the RIO kinase family. It is encoded by the RIOK3 gene and is also known as RIOK3, RIO3, or Rio3p. The protein is composed of 444 amino acids and has a molecular weight of approximately 50 kDa.

The structure of Recombinant Human RIOK3 Protein is characterized by a N-terminal kinase domain and a C-terminal domain. The kinase domain contains the catalytic site responsible for the protein’s kinase activity, while the C-terminal domain is involved in protein-protein interactions. The protein also has several conserved motifs, including a Walker A motif, a Walker B motif, and a P-loop motif, which are important for ATP binding and catalysis.

Recombinant Human RIOK3 Protein is a dimer in its active form, with each monomer containing the kinase and C-terminal domains. The dimerization of the protein is essential for its activity and stability.

The Activity of Recombinant Human RIOK3 Protein

Recombinant Human RIOK3 Protein is a serine/threonine protein kinase that plays a crucial role in various cellular processes, including cell cycle progression, ribosome biogenesis, and DNA damage response. It is involved in the phosphorylation of target proteins, which regulates their function and activity.

The main function of Recombinant Human RIOK3 Protein is its role in ribosome biogenesis. It is an essential component of the RIO kinase complex, which is responsible for the processing of 18S ribosomal RNA and the maturation of the 40S ribosomal subunit. This process is critical for the production of functional ribosomes and protein synthesis.

Additionally, Recombinant Human RIOK3 Protein is involved in the regulation of the cell cycle. It interacts with the tumor suppressor protein p53 and phosphorylates it, leading to its activation and subsequent cell cycle arrest. This activity is crucial for maintaining genomic stability and preventing the development of cancer.

The protein also plays a role in DNA damage response by phosphorylating histone H2AX, which is involved in the repair of DNA double-strand breaks. This activity is essential for maintaining the integrity of the genome and preventing mutations that can lead to diseases such as cancer.

The Application of Recombinant Human RIOK3 Protein

Recombinant Human RIOK3 Protein has various applications in both research and medical fields. Its role in ribosome biogenesis makes it a valuable tool for studying protein synthesis and its regulation. The protein’s involvement in the cell cycle and DNA damage response also makes it a crucial component in cancer research.

Moreover, Recombinant Human RIOK3 Protein has potential therapeutic applications. Its role in regulating the cell cycle and DNA damage response makes it a potential target for cancer treatment. Inhibitors of RIOK3 could be developed to disrupt the protein’s activity and prevent cancer cell proliferation.

The protein’s involvement in ribosome biogenesis also makes it a potential target for antibiotic development. By inhibiting its activity, the production of functional ribosomes could be disrupted, leading to the inhibition of bacterial growth.

Furthermore, Recombinant Human RIOK3 Protein can also be used as an antigen for the production of specific antibodies. These antibodies can then be used in various immunoassays, such as ELISA, Western blot, and immunohistochemistry, for the detection and quantification of the protein in different samples.

In conclusion, Recombinant Human RIOK3 Protein is a crucial protein with diverse functions and applications. Its structure, activity, and role in various cellular processes make it an essential target for research and potential therapeutic development.

Recombinant Human RIOK3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RIOK3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products