Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD115/CSF1R Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P09581
Molecular weight:
21.90 kDa

Original price was: €424.00.Current price is: €329.00.

100ug 22% OFF + 329 loyalty points
Val22–Val198
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD115/CSF1R Protein, N-His

Product name ARO-P11020-100
Uniprot ID P09581
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence VIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRV
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Val198
Aliases /Synonyms CSF-1R, CSF-1-R, Macrophage colony-stimulating factor 1 receptor, M-CSF-R, Fms, CSF-1 receptor, CD115, Csf1r, Csfmr, Proto-oncogene c-Fms
Reference ARO-P11020
Note For research use only.
Molecular Constructor
Val22–Val198
Product name ARO-P11020-1MG
Uniprot ID P09581
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence VIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRV
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Val198
Aliases /Synonyms CSF-1R, CSF-1-R, Macrophage colony-stimulating factor 1 receptor, M-CSF-R, Fms, CSF-1 receptor, CD115, Csf1r, Csfmr, Proto-oncogene c-Fms
Reference ARO-P11020
Note For research use only.
Molecular Constructor
Val22–Val198
Product name ARO-P11020-50
Uniprot ID P09581
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence VIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRV
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Val198
Aliases /Synonyms CSF-1R, CSF-1-R, Macrophage colony-stimulating factor 1 receptor, M-CSF-R, Fms, CSF-1 receptor, CD115, Csf1r, Csfmr, Proto-oncogene c-Fms
Reference ARO-P11020
Note For research use only.
Molecular Constructor
Val22–Val198

Introduction

Recombinant Mouse CD115/CSF1R Protein is a highly versatile and important protein in the field of immunology and cell biology. It is a type I transmembrane protein that belongs to the class III receptor tyrosine kinase family. This protein is also known as Colony Stimulating Factor 1 Receptor (CSF1R) or Macrophage Colony Stimulating Factor Receptor (M-CSFR). It is primarily expressed on the surface of cells of the myeloid lineage, including macrophages, monocytes, and dendritic cells. In this article, we will explore the structure, activity, and applications of Recombinant Mouse CD115/CSF1R Protein.

Structure of Recombinant Mouse CD115/CSF1R Protein

The Recombinant Mouse CD115/CSF1R Protein is a 972 amino acid protein with a predicted molecular mass of approximately 108 kDa. It contains a large extracellular domain, a single transmembrane domain, and a cytoplasmic domain. The extracellular domain consists of five immunoglobulin-like domains, while the cytoplasmic domain contains a tyrosine kinase catalytic domain. The binding of its ligand, Colony Stimulating Factor 1 (CSF1), to the extracellular domain induces dimerization and activation of the tyrosine kinase activity of the cytoplasmic domain.

Activity of Recombinant Mouse CD115/CSF1R Protein

The primary function of Recombinant Mouse CD115/CSF1R Protein is to act as a receptor for the cytokine CSF1. Upon binding of CSF1, the receptor undergoes dimerization and autophosphorylation, leading to the activation of downstream signaling pathways. These signaling pathways play a crucial role in the development, differentiation, and survival of cells of the myeloid lineage. Additionally, Recombinant Mouse CD115/CSF1R Protein also plays a role in regulating the inflammatory response by promoting the recruitment and activation of macrophages and other immune cells to sites of infection or injury.

Applications of Recombinant Mouse CD115/CSF1R Protein

Recombinant Mouse CD115/CSF1R Protein has a wide range of applications in both research and clinical settings. Some of the major applications include:

1. Immunology Research

Recombinant Mouse CD115/CSF1R Protein is a valuable tool for studying the role of CSF1R signaling in various immune cell functions. It can be used to investigate the effects of CSF1R activation on cell proliferation, differentiation, and survival. Additionally, it can also be used to study the interactions between CSF1R and other receptors or signaling pathways in the immune system.

2. Cancer Research

The overexpression of CSF1R has been linked to various types of cancer, including breast cancer, ovarian cancer, and leukemia. Recombinant Mouse CD115/CSF1R Protein can be used to study the role of CSF1R in cancer development and progression. It can also be used to develop potential therapeutic strategies targeting CSF1R in cancer treatment.

3. Drug Development

Recombinant Mouse CD115/CSF1R Protein can be used in drug discovery and development as a target for screening potential CSF1R inhibitors. It can also be used to evaluate the efficacy and safety of CSF1R-targeting drugs in preclinical studies.

4. Diagnostic Tool

The expression of CSF1R has been associated with various diseases, including autoimmune disorders and neurodegenerative diseases. Recombinant Mouse CD115/CSF1R Protein can be used as a diagnostic tool to measure the levels of CSF1R in patient samples, providing valuable information for disease diagnosis and monitoring.

5. Therapeutic Agent

Recombinant Mouse CD

Recombinant Mouse CD115/CSF1R Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD115/CSF1R Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products