Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse EDA2R Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8BX35
Molecular weight:
37.59 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Asp2–Cys86
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse EDA2R Protein, N-GST & C-His

Product name ARO-P10499-100
Uniprot ID Q8BX35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDC
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Cys86
Aliases /Synonyms EDA-A2 receptor, XEDAR, EDA2R, TNFRSF27, X-linked ectodysplasin-A2 receptor, Tumor necrosis factor receptor superfamily member 27
Reference ARO-P10499
Note For research use only.
Molecular Constructor
Asp2–Cys86
Product name ARO-P10499-1MG
Uniprot ID Q8BX35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDC
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Cys86
Aliases /Synonyms EDA-A2 receptor, XEDAR, EDA2R, TNFRSF27, X-linked ectodysplasin-A2 receptor, Tumor necrosis factor receptor superfamily member 27
Reference ARO-P10499
Note For research use only.
Molecular Constructor
Asp2–Cys86
Product name ARO-P10499-50
Uniprot ID Q8BX35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDC
Molecular weight 37.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Cys86
Aliases /Synonyms EDA-A2 receptor, XEDAR, EDA2R, TNFRSF27, X-linked ectodysplasin-A2 receptor, Tumor necrosis factor receptor superfamily member 27
Reference ARO-P10499
Note For research use only.
Molecular Constructor
Asp2–Cys86

Introduction to Recombinant Mouse EDA2R Protein

Recombinant Mouse EDA2R Protein is a genetically engineered protein that is produced in a laboratory setting using recombinant DNA technology. This protein is derived from the mouse EDA2R gene, which codes for the Ectodysplasin A2 receptor (EDA2R). This receptor is a member of the tumor necrosis factor receptor superfamily and plays a crucial role in the development and function of various tissues and organs.

Structure of Recombinant Mouse EDA2R Protein

Recombinant Mouse EDA2R Protein is a transmembrane protein that consists of 391 amino acids. It has a molecular weight of approximately 44 kDa and is composed of an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains two cysteine-rich domains, which are important for ligand binding, and a death domain, which is involved in signal transduction. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain is responsible for transmitting signals to the cell’s interior.

Activity of Recombinant Mouse EDA2R Protein

The main function of Recombinant Mouse EDA2R Protein is to act as a receptor for Ectodysplasin A2 (EDA2), a protein that is involved in the development of skin, hair, teeth, and sweat glands. When EDA2 binds to the extracellular domain of EDA2R, it triggers a signaling cascade that leads to the activation of various transcription factors, such as nuclear factor kappa B (NF-κB) and activator protein 1 (AP-1). These transcription factors regulate the expression of genes that are essential for the development and maintenance of various tissues and organs.

In addition to its role in development, Recombinant Mouse EDA2R Protein has also been implicated in the regulation of immune responses. Studies have shown that this protein is expressed on the surface of immune cells, such as B cells and macrophages, and is involved in the activation and differentiation of these cells. It has also been reported that Recombinant Mouse EDA2R Protein can modulate the production of cytokines, which are important mediators of immune responses.

Application of Recombinant Mouse EDA2R Protein

Recombinant Mouse EDA2R Protein has a wide range of applications in both basic research and clinical settings. In basic research, this protein is used to study the role of EDA2R in development and immune responses. It is also used to investigate the signaling pathways that are activated by EDA2R and its ligands. Recombinant Mouse EDA2R Protein is also a valuable tool for studying the structure and function of other members of the tumor necrosis factor receptor superfamily.

In the clinical setting, Recombinant Mouse EDA2R Protein has potential applications in the treatment of various diseases. For instance, it has been suggested that this protein can be used to treat hypohidrotic ectodermal dysplasia, a rare genetic disorder that is caused by mutations in the EDA2R gene. In addition, studies have shown that Recombinant Mouse EDA2R Protein can have anti-inflammatory effects, which may be beneficial in the treatment of autoimmune diseases and inflammatory disorders.

Conclusion

In summary, Recombinant Mouse EDA2R Protein is a genetically engineered protein that is derived from the mouse EDA2R gene. It is a transmembrane protein that plays a crucial role in development and immune responses. This protein has potential applications in both basic research and clinical settings, and further studies on its structure and function may lead to new therapeutic approaches for various diseases.

Recombinant Mouse EDA2R Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse EDA2R Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products