Name: Sialic acid-binding Ig-like lectin 15(SIGLEC15)
SKU: PX-P4693-10
Availability: InStock

Product name	Sialic acid-binding Ig-like lectin 15(SIGLEC15)
Uniprot ID	Q6ZMC9
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MEKSIWLLACLAWVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTGSHHHHHH
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1-Thr263
Aliases /Synonyms	Siglec-15,CD33 antigen-like 3,CD33L3
Reference	PX-P4693
Note	For research use only

No Products found