Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tazlestobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA2216-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tazlestobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name PX-TA2216-50
Uniprot ID P16410
Source CAS: 2850355-80-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2216-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Tazlestobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2850355-80-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2216-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Tazlestobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2850355-80-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2216-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Tazlestobart Biosimilar, also known as Anti-CD152 mAb, is a therapeutic antibody that has been developed for the treatment of various diseases. It is a biosimilar version of the existing therapeutic antibody, which has shown promising results in clinical trials. In this article, we will discuss the structure, activity, and application of Tazlestobart Biosimilar in detail.

Structure of Tazlestobart Biosimilar

Tazlestobart Biosimilar is a monoclonal antibody that specifically targets CD152, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). It is a fully humanized antibody, meaning it is derived from human cells, making it less likely to cause an immune response in patients. The antibody consists of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains are composed of constant and variable regions, while the light chains only have variable regions. The variable regions are responsible for binding to the CD152 receptor, while the constant regions determine the antibody’s effector function.

Activity of Tazlestobart Biosimilar

Tazlestobart Biosimilar works by binding to the CD152 receptor on the surface of T cells. This receptor is a negative regulator of T cell activation, meaning it inhibits the activation of T cells. By binding to CD152, Tazlestobart Biosimilar prevents the interaction of CD152 with its ligands, CD80 and CD86, which are present on antigen-presenting cells. This results in the activation of T cells, leading to an enhanced immune response against cancer cells or other disease-causing agents. Additionally, Tazlestobart Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which further contribute to its therapeutic activity.

Application of Tazlestobart Biosimilar

Tazlestobart Biosimilar has shown promising results in clinical trials for the treatment of various diseases, including cancer and autoimmune disorders. In cancer, Tazlestobart Biosimilar has been studied as a monotherapy and in combination with other therapies, such as chemotherapy and other immunotherapies. It has shown efficacy in various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. In autoimmune disorders, Tazlestobart Biosimilar has been studied for the treatment of rheumatoid arthritis, psoriasis, and multiple sclerosis. Its ability to modulate the immune response makes it a potential treatment option for these diseases.

Therapeutic Target: CD152

CD152, the therapeutic target of Tazlestobart Biosimilar, is a protein that is primarily expressed on the surface of T cells. It is a negative regulator of T cell activation, meaning it inhibits the activation of T cells. This is important in maintaining immune homeostasis and preventing autoimmune responses. However, in diseases such as cancer, CD152 can be upregulated, leading to a suppression of the immune response against cancer cells. By targeting CD152, Tazlestobart Biosimilar can enhance the immune response against cancer cells and potentially improve patient outcomes.

Conclusion

In summary, Tazlestobart Biosimilar is a therapeutic antibody that specifically targets CD152. It has a unique structure and mechanism of action, which allows it to modulate the immune response and potentially treat a wide range of diseases. Its promising results in clinical trials make it a potential treatment option for cancer and autoimmune disorders. Further research and development of Tazlestobart Biosimilar may lead to its approval and availability for patients in need.

SDS-PAGE for Tazlestobart Biosimilar - Research Grade

SDS-PAGE for Tazlestobart Biosimilar - Research Grade

Tazlestobart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tazlestobart Biosimilar - Research Grade binds to Mouse CD152 recombinant protein in ELISA Assay

Tazlestobart Biosimilar - Research Grade binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Tazlestobart Biosimilar - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Tazlestobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products