Name: Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein
SKU: PX-P1100-10
Availability: InStock

Product name	Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein
Uniprot ID	Q25C69
Uniprot link	http://www.uniprot.org/uniprot/Q25C69
Origin species	Toxoplasma gondii
Expression system	Prokaryotic expression
Sequence	MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTTGRRSPQEPSGDGGGNDAGNNAGNGGNEGRGYGGRGEGGAED DRRPLHPERVNVFDYKLAAALEHHHHHH
Molecular weight	11,54 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, imidazole 300mM
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Protein Accession	BAE86889.1
Spec:SwissProtID	Q25C69
NCBI Reference	BAE86889.1
Aliases /Synonyms	GRA6Ct(174-230)(RH), dense granule antigen
Reference	PX-P1100
Note	For research use only

No Products found