Name: Trichinella spiralis GST24 Recombinant Protein
SKU: PX-P1104-10
Availability: InStock

Product name	Trichinella spiralis GST24 Recombinant Protein
Uniprot ID	Q0H8U8
Uniprot link	http://www.uniprot.org/uniprot/Q0H8U8
Origin species	Trichinella spiralis
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLMPLYKLVYFPIRGLAEPIRLLLHDQRVEFLDNRIQQKDWPEIKSQMLFGQVPCLYEDDQPIVQSGAIMR HLGRRFGLYGNAEEMTYVDQIYEGVVDLRLKYARLIYSDSFHESKGKFINEVLPDELAKFEKILTGKKYILDDEITFADY ALAELLDVLLILSSSCLENFTALTIYHSRFMNRPNLKRYLSSDIRKNAKINGNENK
Molecular weight	25,32 kDa
Protein delivered with Tag?	Yes
Purity estimated	>95%
Buffer	PBS, imidazole 300mM
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Full-length
Protein Accession	ABA42914.1
Spec:SwissProtID	Q0H8U8
NCBI Reference	ABA42914.1
Aliases /Synonyms	GST24, glutathione-S-transferase
Reference	PX-P1104
Note	For research use only

No Products found