Name: Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
SKU: PX-P4778-10
Availability: InStock

Product name	Tumor necrosis factor receptor superfamily member 6(FAS) (Gln26-Asn173)
Uniprot ID	P25445
Uniprot link	https://www.uniprot.org/uniprot/P25445
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF SSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEG SRSN
Molecular weight	16.64 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Gln26-Asn173
Protein Accession	P25445
Spec:Entrez GeneID	355
Spec:NCBI Gene Aliases	APT1; CD95; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6
Spec:SwissProtID	Q6SSE9
NCBI Reference	P25445
Aliases /Synonyms	APT1, FAS1, TNFRSF6,Apo-1 antigen,Apoptosis-mediating surface antigen FAS,FASLG receptor, CD95
Reference	PX-P4778
Note	For research use only

No Products found