Name: Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
SKU: PX-P4696-10
Availability: InStock

Product name	Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
Uniprot ID	Q5U308
Uniprot link	https://www.uniprot.org/uniprot/Q5U308
Expression system	Prokaryotic expression
Sequence	MGPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLGSHHHHHH
Molecular weight	14.1kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>75% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Pro501-Leu613
Protein Accession	Q5U308
Spec:Entrez GeneID	305131
Spec:SwissProtID	Q5U308
NCBI Reference	Q5U308
Aliases /Synonyms	Leucine-rich repeat-containing protein 5,Leucine-rich repeat-containing protein 8D,Lrrc5
Reference	PX-P4696
Note	For research use only

No Products found